SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3om9c1 (3om9 C:14-163)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093432Protein automated matches [226881] (5 species)
    not a true protein
  7. 2093526Species Toxoplasma gondii [TaxId:5811] [233099] (1 PDB entry)
  8. 2093529Domain d3om9c1: 3om9 C:14-163 [233104]
    Other proteins in same PDB: d3om9a2, d3om9a3, d3om9b2, d3om9b3, d3om9c2, d3om9d2
    automated match to d1pzga1
    complexed with nad, oxq

Details for d3om9c1

PDB Entry: 3om9 (more details), 1.98 Å

PDB Description: T. Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ
PDB Compounds: (C:) lactate dehydrogenase

SCOPe Domain Sequences for d3om9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om9c1 c.2.1.5 (C:14-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

SCOPe Domain Coordinates for d3om9c1:

Click to download the PDB-style file with coordinates for d3om9c1.
(The format of our PDB-style files is described here.)

Timeline for d3om9c1: