| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
| Protein automated matches [190159] (12 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187331] (17 PDB entries) |
| Domain d3m9za_: 3m9z A: [180980] automated match to d1ypoa1 complexed with po4 |
PDB Entry: 3m9z (more details), 1.7 Å
SCOPe Domain Sequences for d3m9za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m9za_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikekyns
fwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicq
kely
Timeline for d3m9za_: