SCOPe 2.05: Domain d3m9za_: 3m9z A:

Lineage for d3m9za_ (3m9z A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (13 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (22 PDB entries)

8. Domain d3m9za_: 3m9z A: [180980]
   automated match to d1ypoa1
   complexed with po4

Details for d3m9za_

PDB Entry: 3m9z, 1.7 Å

PDB Description: Crystal Structure of extracellular domain of mouse NKR-P1A

PDB Compounds: (A:) Killer cell lectin-like receptor subfamily B member 1A

SCOPe Domain Sequences for d3m9za_:

Sequence; same for both SEQRES and ATOM records:

>d3m9za_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikekyns
fwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicq
kely

Timeline for d3m9za_:

• d3m9za_ first appeared in SCOPe 2.01
  
• d3m9za_ appears in SCOPe 2.04
  
• d3m9za_ appears in SCOPe 2.06
  
• d3m9za_ appears in the current release, SCOPe 2.08