PDB entry 3m9z

View 3m9z on RCSB PDB site
Description: Crystal Structure of extracellular domain of mouse NKR-P1A
Class: signaling protein
Keywords: C-type lectin-like domain, domain swapping, disulfide bond, receptor, transmembrane protein, natural killer cell receptor, SIGNALING PROTEIN
Deposited on 2010-03-23, released 2011-04-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.197
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1A
    Species: MUS MUSCULUS [TaxId:10090]
    Gene: Klrb1a, Ly55, Ly55a, Nkrp1a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27811
      • variant (21)
      • variant (93)
    Domains in SCOPe 2.04: d3m9za_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3m9zA (A:)
saklecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikek
ynsfwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrw
icqkelyhetlsnyvgygh

    Sequence, based on observed residues (ATOM records): (download) 
    >3m9zA (A:)
lecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikekyns
fwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrwicq
kely