Lineage for d3m2vc_ (3m2v C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197885Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2197886Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2197887Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 2197888Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (14 PDB entries)
  8. 2197913Domain d3m2vc_: 3m2v C: [180767]
    Other proteins in same PDB: d3m2va1, d3m2va2, d3m2vb1, d3m2vb2, d3m2vd1, d3m2vd2, d3m2ve1, d3m2ve2
    automated match to d1hbmc_
    complexed with act, com, edo, f43, mg, tp7, xp8, zn

Details for d3m2vc_

PDB Entry: 3m2v (more details), 1.8 Å

PDB Description: structural insight into methyl-coenzyme m reductase chemistry using coenzyme b analogues
PDB Compounds: (C:) Methyl-coenzyme M reductase I subunit gamma

SCOPe Domain Sequences for d3m2vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m2vc_ d.58.31.1 (C:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnle

SCOPe Domain Coordinates for d3m2vc_:

Click to download the PDB-style file with coordinates for d3m2vc_.
(The format of our PDB-style files is described here.)

Timeline for d3m2vc_: