Lineage for d3lgib_ (3lgi B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545312Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1545508Protein automated matches [190306] (4 species)
    not a true protein
  7. 1545509Species Escherichia coli K-12 [TaxId:83333] [225952] (8 PDB entries)
  8. 1545511Domain d3lgib_: 3lgi B: [212875]
    automated match to d2qf3a1
    complexed with po4

Details for d3lgib_

PDB Entry: 3lgi (more details), 1.65 Å

PDB Description: structure of the protease domain of degs (degs-deltapdz) at 1.65 a
PDB Compounds: (B:) Protease degS

SCOPe Domain Sequences for d3lgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lgib_ b.47.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lnplstpqfdstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqr
gyiitnkhvindadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrv
phigdvvlaignpynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvns
lgelmgintlsfdksndgetpegigfaipfqlatkimdklirdgrvir

SCOPe Domain Coordinates for d3lgib_:

Click to download the PDB-style file with coordinates for d3lgib_.
(The format of our PDB-style files is described here.)

Timeline for d3lgib_: