Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225952] (8 PDB entries) |
Domain d3lgia_: 3lgi A: [212874] automated match to d2qf3a1 complexed with po4 |
PDB Entry: 3lgi (more details), 1.65 Å
SCOPe Domain Sequences for d3lgia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lgia_ b.47.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} fdstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkh vindadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvl aignpynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgin tlsfdksndgetpegigfaipfqlatkimdklirdgrvir
Timeline for d3lgia_: