SCOPe 2.04: Domain d3lgic_: 3lgi C:

Lineage for d3lgic_ (3lgi C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225952] (8 PDB entries)

8. Domain d3lgic_: 3lgi C: [212876]
   automated match to d2qf3a1
   complexed with po4

Details for d3lgic_

PDB Entry: 3lgi, 1.65 Å

PDB Description: structure of the protease domain of degs (degs-deltapdz) at 1.65 a

PDB Compounds: (C:) Protease degS

SCOPe Domain Sequences for d3lgic_:

Sequence, based on SEQRES records:

>d3lgic_ b.47.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dstdetpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhv
indadqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvla
ignpynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgint
lsfdksndgetpegigfaipfqlatkimdklirdgrvir

Sequence, based on observed residues (ATOM records):

>d3lgic_ b.47.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dstdetpasynlavrraapavvnvynrglnnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklirdgrvir

Timeline for d3lgic_:

• d3lgic_ first appeared in SCOPe 2.03
  
• d3lgic_ appears in SCOPe 2.05
  
• d3lgic_ appears in the current release, SCOPe 2.08