Lineage for d3js1a_ (3js1 A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily)
barrel, closed or opened; n=8, S=12; meanderSuperfamily b.60.1: Lipocalins [50814] (10 families) 
bind hydrophobic ligands in their interior
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
ten-stranded meander beta-sheet folded upon itself
relates to the common fold by opening the barrel and insertion of beta-hairpin
Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [50857] (19 PDB entries) 
Domain d3js1a_: 3js1 A: [178746]
automated match to d1a18a_
complexed with po4
Details for d3js1a_
PDB Entry: 3js1 (more details), 1.81 Å
PDB Description: Crystal structure of adipocyte fatty acid binding protein covalently modified with 4-hydroxy-2-nonenal
PDB Compounds: (A:) Adipocyte fatty acid-binding proteinSCOPe Domain Sequences for d3js1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js1a_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk
gvtstrvyera
SCOPe Domain Coordinates for d3js1a_:
Click to download the PDB-style file with coordinates for d3js1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3js1a_:
- d3js1a_ first appeared in SCOPe 2.01
- d3js1a_ appears in SCOPe 2.03
- d3js1a_ appears in SCOPe 2.05
- d3js1a_ appears in the current release, SCOPe 2.08
View in 3D
