PDB entry 3js1

View 3js1 on RCSB PDB site
Description: Crystal structure of adipocyte fatty acid binding protein covalently modified with 4-hydroxy-2-nonenal
Class: lipid binding protein
Keywords: lipid binding protein, fatty acid binding protein, 4-hydroxy-2-nonenal modified cysteine
Deposited on 2009-09-09, released 2010-08-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Adipocyte fatty acid-binding protein
  Species: Mus musculus [TaxId:10090]
  Gene: Fabp4, Ap2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04117 (0-130)
  Domains in SCOPe 2.04: d3js1a_
• Chain 'B':
  Compound: Adipocyte fatty acid-binding protein
  Species: Mus musculus [TaxId:10090]
  Gene: Fabp4, Ap2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04117 (0-130)
  Domains in SCOPe 2.04: d3js1b_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3js1A (A:)
  cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
  eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk
  gvtstrvyera
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3js1B (B:)
  cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
  eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk
  gvtstrvyera