Lineage for d1a18a_ (1a18 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1552171Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1552172Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 1552191Species Mouse (Mus musculus) [TaxId:10090] [50857] (19 PDB entries)
  8. 1552206Domain d1a18a_: 1a18 A: [27192]

Details for d1a18a_

PDB Entry: 1a18 (more details), 2.4 Å

PDB Description: phenanthroline modified murine adipocyte lipid binding protein
PDB Compounds: (A:) adipocyte lipid binding protein

SCOPe Domain Sequences for d1a18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a18a_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus) [TaxId: 10090]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvecvmk
gvtstrvyera

SCOPe Domain Coordinates for d1a18a_:

Click to download the PDB-style file with coordinates for d1a18a_.
(The format of our PDB-style files is described here.)

Timeline for d1a18a_: