Lineage for d1a18__ (1a18 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16579Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins)
  6. 16580Protein Adipocyte lipid-binding protein, ALBP [50856] (1 species)
  7. 16581Species Mouse (Mus musculus) [TaxId:10090] [50857] (12 PDB entries)
  8. 16590Domain d1a18__: 1a18 - [27192]

Details for d1a18__

PDB Entry: 1a18 (more details), 2.4 Å

PDB Description: phenanthroline modified murine adipocyte lipid binding protein

SCOP Domain Sequences for d1a18__:

Sequence, based on SEQRES records: (download)

>d1a18__ b.60.1.2 (-) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus)}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvexvmk
gvtstrvyera

Sequence, based on observed residues (ATOM records): (download)

>d1a18__ b.60.1.2 (-) Adipocyte lipid-binding protein, ALBP {Mouse (Mus musculus)}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdlvtirsestfknt
eisfklgvefdeitaddrkvksiitldggalvqvqkwdgksttikrkrdgdklvvevmkg
vtstrvyera

SCOP Domain Coordinates for d1a18__:

Click to download the PDB-style file with coordinates for d1a18__.
(The format of our PDB-style files is described here.)

Timeline for d1a18__: