Lineage for d3jb9b5 (3jb9 B:674-842)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537275Protein Pre-mRNA splicing factor Cwf10, domain IV [346092] (1 species)
  7. 2537276Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346351] (1 PDB entry)
  8. 2537277Domain d3jb9b5: 3jb9 B:674-842 [344801]
    Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
    protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9b5

PDB Entry: 3jb9 (more details), 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
PDB Compounds: (B:) Pre-mRNA-splicing factor cwf10

SCOPe Domain Sequences for d3jb9b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jb9b5 d.14.1.1 (B:674-842) Pre-mRNA splicing factor Cwf10, domain IV {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
arfcetavdtssikcfsdtpnkknritmvveplekgisndiengkvninwpqkriseffq
knydwdllasrsiwafgpddrgtnilrddtlstdvdknvlnsvkeyikqgfqwgtregpl
cdetirnvnfrlmdvvlapeqiyrgggqiiptarrvcyssfltasprlm

SCOPe Domain Coordinates for d3jb9b5:

Click to download the PDB-style file with coordinates for d3jb9b5.
(The format of our PDB-style files is described here.)

Timeline for d3jb9b5: