SCOPe 2.07: Domain d3jb9s1: 3jb9 S:1-57

Lineage for d3jb9s1 (3jb9 S:1-57)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.2: U-box [90222] (5 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein Pre-mRNA splicing factor Prp19 [90223] (2 species)

7. Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346436] (1 PDB entry)

8. Domain d3jb9s1: 3jb9 S:1-57 [344813]
   Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b4, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s2, d3jb9t2, d3jb9u2, d3jb9u3, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_
   protein/RNA complex; complexed with adp, gdp, mg, zn

Details for d3jb9s1

PDB Entry: 3jb9, 3.6 Å

PDB Description: cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution

PDB Compounds: (S:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d3jb9s1:

Sequence; same for both SEQRES and ATOM records:

>d3jb9s1 g.44.1.2 (S:1-57) Pre-mRNA splicing factor Prp19 {Schizosaccharomyces pombe 972h- [TaxId: 284812]}
mfcsisgetpkepvisrvsgnvyekrlieqviretskdpvtqqectledlvpvkvpd

Timeline for d3jb9s1:

• d3jb9s1 is new in SCOPe 2.07-stable
  
• d3jb9s1 appears in the current release, SCOPe 2.08