![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Pre-mRNA splicing factor Cwf10, domains III and V [346096] (1 species) |
![]() | Species Schizosaccharomyces pombe 972h- [TaxId:284812] [346362] (1 PDB entry) |
![]() | Domain d3jb9b4: 3jb9 B:843-971 [344800] Other proteins in same PDB: d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9b1, d3jb9b2, d3jb9b5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ protein/RNA complex; complexed with adp, gdp, mg, zn |
PDB Entry: 3jb9 (more details), 3.6 Å
SCOPe Domain Sequences for d3jb9b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jb9b4 d.58.11.1 (B:843-971) Pre-mRNA splicing factor Cwf10, domains III and V {Schizosaccharomyces pombe 972h- [TaxId: 284812]} epvymvevhapadslpiiydlltrrrghvlqdiprpgsplylvralipvidscgfetdlr vhtqgqamcqmvfdhwqvvpgdpldksikpkplepargsdlardfliktrrrkglvedvs ttryfdqem
Timeline for d3jb9b4:
![]() Domains from same chain: (mouse over for more information) d3jb9b1, d3jb9b2, d3jb9b3, d3jb9b5 |
![]() Domains from other chains: (mouse over for more information) d3jb9a1, d3jb9a2, d3jb9a3, d3jb9a4, d3jb9a5, d3jb9c_, d3jb9e_, d3jb9f_, d3jb9g_, d3jb9h_, d3jb9i_, d3jb9j_, d3jb9k_, d3jb9l_, d3jb9m_, d3jb9r_, d3jb9s1, d3jb9s2, d3jb9t1, d3jb9t2, d3jb9u1, d3jb9u2, d3jb9u3, d3jb9v1, d3jb9v2, d3jb9w_, d3jb9x1, d3jb9x2, d3jb9x3, d3jb9x4, d3jb9y1, d3jb9y2, d3jb9z_ |