Lineage for d3gvya_ (3gvy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2703159Species Rhodobacter sphaeroides [TaxId:272943] [189145] (1 PDB entry)
  8. 2703160Domain d3gvya_: 3gvy A: [177048]
    automated match to d1jgca_
    complexed with fe, hem

Details for d3gvya_

PDB Entry: 3gvy (more details), 2.8 Å

PDB Description: crystal structure of bacterioferritin from r.sphaeroides
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d3gvya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvya_ a.25.1.1 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
eeliadeeghidyletqidlmgsigeqnygmlnakpa

SCOPe Domain Coordinates for d3gvya_:

Click to download the PDB-style file with coordinates for d3gvya_.
(The format of our PDB-style files is described here.)

Timeline for d3gvya_: