Lineage for d1jgca_ (1jgc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701406Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2701711Species Rhodobacter capsulatus [TaxId:1061] [69004] (1 PDB entry)
  8. 2701712Domain d1jgca_: 1jgc A: [66673]
    complexed with hem

Details for d1jgca_

PDB Entry: 1jgc (more details), 2.6 Å

PDB Description: The 2.6 A Structure Resolution of Rhodobacter capsulatus Bacterioferritin with Metal-free Dinuclear Site and Heme Iron in a Crystallographic Special Position
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d1jgca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]}
mkgdakvieflnaalrseltaisqywvhfrlqedwglakmakksreesieemghadkiia
rilfleghpnlqkldplrigegpretlecdlagehdalklyreardycaevgdivsknif
eslitdeeghvdfletqislydrlgpqgfallnaapmdaa

SCOPe Domain Coordinates for d1jgca_:

Click to download the PDB-style file with coordinates for d1jgca_.
(The format of our PDB-style files is described here.)

Timeline for d1jgca_: