Lineage for d3fn1b_ (3fn1 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898682Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1898683Protein automated matches [190120] (6 species)
    not a true protein
  7. 1898688Species Human (Homo sapiens) [TaxId:9606] [186843] (16 PDB entries)
  8. 1898701Domain d3fn1b_: 3fn1 B: [210015]
    Other proteins in same PDB: d3fn1a_
    automated match to d4jqua_

Details for d3fn1b_

PDB Entry: 3fn1 (more details), 2.5 Å

PDB Description: e2-ring expansion of the nedd8 cascade confers specificity to cullin modification.
PDB Compounds: (B:) NEDD8-conjugating enzyme UBE2F

SCOPe Domain Sequences for d3fn1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fn1b_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
strrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqggkfqfet
evpdaynmvppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkdvvwglns
lftdllnfddplnieaaehhlrdkedfrnkvddyikryar

SCOPe Domain Coordinates for d3fn1b_:

Click to download the PDB-style file with coordinates for d3fn1b_.
(The format of our PDB-style files is described here.)

Timeline for d3fn1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fn1a_