Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
Protein automated matches [190120] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries) |
Domain d3fn1b_: 3fn1 B: [210015] Other proteins in same PDB: d3fn1a_ automated match to d4jqua_ |
PDB Entry: 3fn1 (more details), 2.5 Å
SCOPe Domain Sequences for d3fn1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fn1b_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} strrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqggkfqfet evpdaynmvppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkdvvwglns lftdllnfddplnieaaehhlrdkedfrnkvddyikryar
Timeline for d3fn1b_: