SCOPe 2.08: Domain d3fn1b_: 3fn1 B:

Lineage for d3fn1b_ (3fn1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)

8. Domain d3fn1b_: 3fn1 B: [210015]
   Other proteins in same PDB: d3fn1a_
   automated match to d4jqua_

Details for d3fn1b_

PDB Entry: 3fn1, 2.5 Å

PDB Description: e2-ring expansion of the nedd8 cascade confers specificity to cullin modification.

PDB Compounds: (B:) NEDD8-conjugating enzyme UBE2F

SCOPe Domain Sequences for d3fn1b_:

Sequence; same for both SEQRES and ATOM records:

>d3fn1b_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
strrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqggkfqfet
evpdaynmvppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkdvvwglns
lftdllnfddplnieaaehhlrdkedfrnkvddyikryar

Timeline for d3fn1b_:

• d3fn1b_ first appeared in SCOPe 2.03
  
• d3fn1b_ appears in SCOPe 2.07