PDB entry 3fn1

View 3fn1 on RCSB PDB site
Description: E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.
Class: ligase
Keywords: Ligase, ATP-binding, Cell cycle, Nucleotide-binding, Ubl conjugation pathway
Deposited on 2008-12-22, released 2009-03-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD8-activating enzyme E1 catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: E1C, UBA3, UBE1C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TBC4
      • engineered (49)
    Domains in SCOPe 2.05: d3fn1a_
  • Chain 'B':
    Compound: NEDD8-conjugating enzyme UBE2F
    Species: Homo sapiens [TaxId:9606]
    Gene: NCE2, UBE2F
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3fn1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fn1A (A:)
    gssqlpqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlymqsvtsieert
    rpnlsktlkelglvdgqelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fn1A (A:)
    pqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlymqsvtsieertrpnls
    ktlkelglvdgqelavadvttpqtvlfklhft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fn1B (B:)
    gsatasdstrrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqg
    gkfqfetevpdaynmvppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkd
    vvwglnslftdllnfddplnieaaehhlrdkedfrnkvddyikryar
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fn1B (B:)
    strrvsvrdkllvkevaeleanlpctckvhfpdpnklhcfqltvtpdegyyqggkfqfet
    evpdaynmvppkvkcltkiwhpnitetgeiclsllrehsidgtgwaptrtlkdvvwglns
    lftdllnfddplnieaaehhlrdkedfrnkvddyikryar