Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries) |
Domain d3fhcb_: 3fhc B: [209923] automated match to d2g9nb_ protein/RNA complex |
PDB Entry: 3fhc (more details), 2.8 Å
SCOPe Domain Sequences for d3fhcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fhcb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl ayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghq dqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklk
Timeline for d3fhcb_: