Lineage for d2g9nb_ (2g9n B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
duplication: tandem repeat of two RecA-like (AAA) domains
Protein Initiation factor 4a [52706] (2 species)
homologous to UvrB
Species Human (Homo sapiens) [TaxId:9606] [142305] (3 PDB entries)
Uniprot P60842 21-238
4A-I
Domain d2g9nb_: 2g9n B: [134815]
automated match to d1fuua_
Details for d2g9nb_
PDB Entry: 2g9n (more details), 2.25 Å
PDB Description: Structure of the DEAD domain of Human eukaryotic initiation factor 4A, eIF4A
PDB Compounds: (B:) Eukaryotic initiation factor 4A-ISCOPe Domain Sequences for d2g9nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g9nb_ c.37.1.19 (B:) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}
iesnwneivdsfddmnlsesllrgiyaygfekpsaiqqrailpcikgydviaqaqsgtgk
tatfaisilqqieldlkatqalvlaptrelaqqiqkvvmalgdymgaschaciggtnvra
evqklqmeaphiivgtpgrvfdmlnrrylspkyikmfvldeademlsrgfkdqiydifqk
lnsntqvvllsatmpsdvlevtkkfmrdpirilvk
SCOPe Domain Coordinates for d2g9nb_:
Click to download the PDB-style file with coordinates for d2g9nb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g9nb_:
- d2g9nb_ first appeared in SCOP 1.73, called d2g9nb1
- d2g9nb_ appears in SCOPe 2.06
- d2g9nb_ appears in the current release, SCOPe 2.08
View in 3D
