Lineage for d3fhcb_ (3fhc B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872381Domain d3fhcb_: 3fhc B: [209923]
    automated match to d2g9nb_
    protein/RNA complex

Details for d3fhcb_

PDB Entry: 3fhc (more details), 2.8 Å

PDB Description: crystal structure of human dbp5 in complex with nup214
PDB Compounds: (B:) ATP-dependent RNA helicase DDX19B

SCOPe Domain Sequences for d3fhcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhcb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl
iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl
ayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghq
dqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklk

SCOPe Domain Coordinates for d3fhcb_:

Click to download the PDB-style file with coordinates for d3fhcb_.
(The format of our PDB-style files is described here.)

Timeline for d3fhcb_: