Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily) beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops |
Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) duplication: consists of 4 structural repeats arranged in 2 lobes contains one left-hand beta-alpha-beta unit per lobe automatically mapped to Pfam PF02738 |
Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins) |
Protein automated matches [230468] (3 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232097] (10 PDB entries) |
Domain d3etrc2: 3etr C:695-1325 [232107] Other proteins in same PDB: d3etra1, d3etra2, d3etrb1, d3etrb2, d3etrc1, d3etrl1, d3etrl2, d3etrm1, d3etrm2, d3etrn1 automated match to d1v97a5 complexed with ca, fad, fes, luz, mos, mte |
PDB Entry: 3etr (more details), 2.2 Å
SCOPe Domain Sequences for d3etrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3etrc2 d.133.1.1 (C:695-1325) automated matches {Cow (Bos taurus) [TaxId: 9913]} iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf rldspatpekirnacvdkfttlcvtgapgnc
Timeline for d3etrc2: