Lineage for d3etrl2 (3etr L:93-165)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715334Protein automated matches [232101] (1 species)
    not a true protein
  7. 2715335Species Cow (Bos taurus) [TaxId:9913] [232106] (10 PDB entries)
  8. 2715353Domain d3etrl2: 3etr L:93-165 [232117]
    Other proteins in same PDB: d3etra1, d3etrb1, d3etrb2, d3etrc1, d3etrc2, d3etrl1, d3etrm1, d3etrm2, d3etrn1, d3etrn2
    automated match to d1v97a1
    complexed with ca, fad, fes, luz, mos, mte

Details for d3etrl2

PDB Entry: 3etr (more details), 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine
PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etrl2 a.56.1.1 (L:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3etrl2:

Click to download the PDB-style file with coordinates for d3etrl2.
(The format of our PDB-style files is described here.)

Timeline for d3etrl2: