Lineage for d3etrc2 (3etr C:695-1325)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432242Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1432243Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 1432244Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 1432326Protein automated matches [230468] (2 species)
    not a true protein
  7. 1432327Species Bos taurus [TaxId:9913] [232097] (4 PDB entries)
  8. 1432332Domain d3etrc2: 3etr C:695-1325 [232107]
    Other proteins in same PDB: d3etrb1, d3etrb2, d3etrc1, d3etrl1, d3etrl2, d3etrm1, d3etrm2
    automated match to d1v97a5
    complexed with ca, fad, fes, luz, mos, mte

Details for d3etrc2

PDB Entry: 3etr (more details), 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine
PDB Compounds: (C:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etrc2 d.133.1.1 (C:695-1325) automated matches {Bos taurus [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlcvtgapgnc

SCOPe Domain Coordinates for d3etrc2:

Click to download the PDB-style file with coordinates for d3etrc2.
(The format of our PDB-style files is described here.)

Timeline for d3etrc2: