SCOPe 2.08: Domain d3etrn1: 3etr N:571-694

Lineage for d3etrn1 (3etr N:571-694)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232071] (10 PDB entries)

8. Domain d3etrn1: 3etr N:571-694 [232077]
   Other proteins in same PDB: d3etra1, d3etra2, d3etrb1, d3etrb2, d3etrc2, d3etrl1, d3etrl2, d3etrm1, d3etrm2, d3etrn2
   automated match to d3etrc1
   complexed with ca, fad, fes, luz, mos, mte

Details for d3etrn1

PDB Entry: 3etr, 2.2 Å

PDB Description: crystal structure of xanthine oxidase in complex with lumazine

PDB Compounds: (N:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3etrn1:

Sequence; same for both SEQRES and ATOM records:

>d3etrn1 d.41.1.0 (N:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3etrn1:

• d3etrn1 first appeared in SCOPe 2.03
  
• d3etrn1 appears in SCOPe 2.07