Lineage for d3ch0a_ (3ch0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825748Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 1825830Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 1825831Protein automated matches [190919] (10 species)
    not a true protein
  7. 1825839Species Cytophaga hutchinsonii [TaxId:269798] [195100] (1 PDB entry)
  8. 1825840Domain d3ch0a_: 3ch0 A: [195101]
    automated match to d2pz0b_
    complexed with cit, edo, gol

Details for d3ch0a_

PDB Entry: 3ch0 (more details), 1.5 Å

PDB Description: crystal structure of glycerophosphoryl diester phosphodiesterase (yp_677622.1) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution
PDB Compounds: (A:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d3ch0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ch0a_ c.1.18.0 (A:) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
gmiqvpasfdiqghrgcrgllpentiaaftkalllgvttlefdlviskdnrvvvshdtff
hheitmmvdgedvteaneknfnlyamnyadikeidvgmkthprfksqkkvpavkplfrel
ietaeklsakiqyngeikstvegdnidhpnialfcdlvvaeikkahitdrftlqsfdvra
leymhsqypdiklsylvetkgtlkkqleklsftpavyspdvtlvskkdidaahklgmrvi
pwtvntkeeietlislgvdgiitdypdlffek

SCOPe Domain Coordinates for d3ch0a_:

Click to download the PDB-style file with coordinates for d3ch0a_.
(The format of our PDB-style files is described here.)

Timeline for d3ch0a_: