Lineage for d3c9ub1 (3c9u B:-5-137)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658121Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1658122Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1658178Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species)
  7. 1658179Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries)
    Uniprot O67883
  8. 1658181Domain d3c9ub1: 3c9u B:-5-137 [156146]
    Other proteins in same PDB: d3c9ua2, d3c9ub2
    automated match to d3c9ub1
    complexed with adp, mg, tpp

Details for d3c9ub1

PDB Entry: 3c9u (more details), 1.48 Å

PDB Description: aathil complexed with adp and tpp
PDB Compounds: (B:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d3c9ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c9ub1 d.79.4.1 (B:-5-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]}
fqgsftmrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrs
yipeavgwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykce
vvggnisksekigisvflvgete

SCOPe Domain Coordinates for d3c9ub1:

Click to download the PDB-style file with coordinates for d3c9ub1.
(The format of our PDB-style files is described here.)

Timeline for d3c9ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c9ub2