![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
![]() | Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
![]() | Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
![]() | Protein Thiamine monophosphate kinase (ThiL) C-terminal domain [118111] (1 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [118112] (5 PDB entries) Uniprot O67883 |
![]() | Domain d3c9ua2: 3c9u A:138-306 [156145] Other proteins in same PDB: d3c9ua1, d3c9ub1 automated match to d3c9ua2 complexed with adp, mg, tpp |
PDB Entry: 3c9u (more details), 1.48 Å
SCOPe Domain Sequences for d3c9ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9ua2 d.139.1.1 (A:138-306) Thiamine monophosphate kinase (ThiL) C-terminal domain {Aquifex aeolicus [TaxId: 63363]} rfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyepfelaliqrhlrptaridyvkh iqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmycekygknpieyalf ggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvepkgwkhf
Timeline for d3c9ua2: