Lineage for d3c7kb_ (3c7k B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496843Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1496844Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1496845Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 1496870Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species)
  7. 1496874Species Mouse (Mus musculus) [TaxId:10090] [188430] (2 PDB entries)
  8. 1496877Domain d3c7kb_: 3c7k B: [173069]
    automated match to d2ik8b1
    complexed with alf, gdp, mg

Details for d3c7kb_

PDB Entry: 3c7k (more details), 2.9 Å

PDB Description: molecular architecture of galphao and the structural basis for rgs16- mediated deactivation
PDB Compounds: (B:) Regulator of G-protein signaling 16

SCOPe Domain Sequences for d3c7kb_:

Sequence, based on SEQRES records: (download)

>d3c7kb_ a.91.1.1 (B:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
vlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhif
deyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspayr

Sequence, based on observed residues (ATOM records): (download)

>d3c7kb_ a.91.1.1 (B:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]}
vlgwrsfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhifd
eyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspayr

SCOPe Domain Coordinates for d3c7kb_:

Click to download the PDB-style file with coordinates for d3c7kb_.
(The format of our PDB-style files is described here.)

Timeline for d3c7kb_: