PDB entry 3c7k

View 3c7k on RCSB PDB site
Description: Molecular architecture of Galphao and the structural basis for RGS16-mediated deactivation
Class: signaling protein
Keywords: RGS, Galpha, AlF4 heterotrimeric G-protein GAP, Alternative splicing, GTP-binding, Lipoprotein, Myristate, Nucleotide-binding, Palmitate, Transducer, Phosphoprotein, Signal transduction inhibitor, SIGNALING PROTEIN
Deposited on 2008-02-07, released 2008-05-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(o) subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Gnao1, Gna0, Gnao
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Regulator of G-protein signaling 16
    Species: Mus musculus [TaxId:10090]
    Gene: RGS16, RGSR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c7kb_
  • Chain 'C':
    Compound: Guanine nucleotide-binding protein G(o) subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Gnao1, Gna0, Gnao
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Regulator of G-protein signaling 16
    Species: Mus musculus [TaxId:10090]
    Gene: RGS16, RGSR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3c7kd_
  • Heterogens: MG, ALF, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c7kB (B:)
    gsfsedvlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklas
    rahhifdeyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprfl
    kspayrdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c7kB (B:)
    vlgwrsfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhifd
    eyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspayr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c7kD (D:)
    gsfsedvlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklas
    rahhifdeyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprfl
    kspayrdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c7kD (D:)
    sfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhifdeyirs
    eapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspay