Class a: All alpha proteins [46456] (284 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
Protein Regulator of G-protein signaling 16, RGS16 [158689] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [188430] (1 PDB entry) |
Domain d3c7kb_: 3c7k B: [173069] automated match to d2ik8b1 complexed with alf, gdp, mg |
PDB Entry: 3c7k (more details), 2.9 Å
SCOPe Domain Sequences for d3c7kb_:
Sequence, based on SEQRES records: (download)
>d3c7kb_ a.91.1.1 (B:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]} vlgwresfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhif deyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspayr
>d3c7kb_ a.91.1.1 (B:) Regulator of G-protein signaling 16, RGS16 {Mouse (Mus musculus) [TaxId: 10090]} vlgwrsfdlllnskngvaafhaflktefseenlefwlaceefkkirsatklasrahhifd eyirseapkevnidhetreltktnlqaattscfdvaqgktrtlmekdsyprflkspayr
Timeline for d3c7kb_: