Lineage for d3bwga1 (3bwg A:5-82)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982868Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins)
  6. 1982882Protein Transcriptional regulator YydK [158280] (1 species)
  7. 1982883Species Bacillus subtilis [TaxId:1423] [158281] (1 PDB entry)
    Uniprot Q45591 5-82
  8. 1982884Domain d3bwga1: 3bwg A:5-82 [155693]
    Other proteins in same PDB: d3bwga2, d3bwgb2, d3bwgc2
    complexed with edo

Details for d3bwga1

PDB Entry: 3bwg (more details), 2.09 Å

PDB Description: The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168
PDB Compounds: (A:) Uncharacterized HTH-type transcriptional regulator yydK

SCOPe Domain Sequences for d3bwga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]}
qqiateietyieehqlqqgdklpvletlmaqfevskstitkslelleqkgaifqvrgsgi
fvrkhkrkgyisllsnqg

SCOPe Domain Coordinates for d3bwga1:

Click to download the PDB-style file with coordinates for d3bwga1.
(The format of our PDB-style files is described here.)

Timeline for d3bwga1: