SCOPe 2.06: Domain d3bwgb1: 3bwg B:1-81

Lineage for d3bwgb1 (3bwg B:1-81)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins)

6. Protein Transcriptional regulator YydK [158280] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158281] (1 PDB entry)
   Uniprot Q45591 5-82

8. Domain d3bwgb1: 3bwg B:1-81 [155695]
   Other proteins in same PDB: d3bwga2, d3bwgb2, d3bwgc2
   automated match to d3bwga1
   complexed with edo

Details for d3bwgb1

PDB Entry: 3bwg, 2.09 Å

PDB Description: The crystal structure of possible transcriptional regulator YydK from Bacillus subtilis subsp. subtilis str. 168

PDB Compounds: (B:) Uncharacterized HTH-type transcriptional regulator yydK

SCOPe Domain Sequences for d3bwgb1:

Sequence; same for both SEQRES and ATOM records:

>d3bwgb1 a.4.5.6 (B:1-81) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]}
mlkyqqiateietyieehqlqqgdklpvletlmaqfevskstitkslelleqkgaifqvr
gsgifvrkhkrkgyisllsnq

Timeline for d3bwgb1:

• d3bwgb1 first appeared in SCOP 1.75
  
• d3bwgb1 appears in SCOPe 2.05
  
• d3bwgb1 appears in SCOPe 2.07
  
• d3bwgb1 appears in the current release, SCOPe 2.08