![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.6: GntR-like transcriptional regulators [46804] (4 proteins) |
![]() | Protein Transcriptional regulator YydK [158280] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [158281] (1 PDB entry) Uniprot Q45591 5-82 |
![]() | Domain d3bwga1: 3bwg A:5-82 [155693] Other proteins in same PDB: d3bwga2, d3bwgb2, d3bwgc2 complexed with edo |
PDB Entry: 3bwg (more details), 2.09 Å
SCOPe Domain Sequences for d3bwga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} qqiateietyieehqlqqgdklpvletlmaqfevskstitkslelleqkgaifqvrgsgi fvrkhkrkgyisllsnqg
Timeline for d3bwga1:
![]() Domains from other chains: (mouse over for more information) d3bwgb1, d3bwgb2, d3bwgc1, d3bwgc2 |