Lineage for d3axyc_ (3axy C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. Protein automated matches [190238] (5 species)
    not a true protein
  7. 1501438Species Oryza sativa [TaxId:39947] [189745] (1 PDB entry)
  8. 1501439Domain d3axyc_: 3axy C: [172373]
    automated match to d1o9ca_
    protein/DNA complex

Details for d3axyc_

PDB Entry: 3axy (more details), 2.4 Å

PDB Description: Structure of Florigen Activation Complex Consisting of Rice Florigen Hd3a, 14-3-3 Protein GF14 and Rice FD Homolog OsFD1
PDB Compounds: (C:) 14-3-3-like protein GF14-C

SCOPe Domain Sequences for d3axyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3axyc_ a.118.7.1 (C:) automated matches {Oryza sativa [TaxId: 39947]}
msreenvymaklaeqaeryeemveymekvaktvdveeltveernllsvayknvigarras
wrivssieqkeegrgneehvtlikeyrgkieaelskicdgilklldshlvpsstaaeskv
fylkmkgdyhrylaefktgaerkeaaestmvaykaaqdialadlapthpirlglalnfsv
fyyeilnspdkacnlakqafdeaiseldtlgeesykdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d3axyc_:

Click to download the PDB-style file with coordinates for d3axyc_.
(The format of our PDB-style files is described here.)

Timeline for d3axyc_: