SCOPe 2.08: Domain d3a74a1: 3a74 A:4-145

Lineage for d3a74a1 (3a74 A:4-145)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
barrel, closed; n=5, S=10
Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species)
Species Geobacillus stearothermophilus [TaxId:1422] [225968] (1 PDB entry)
Domain d3a74a1: 3a74 A:4-145 [208133]
Other proteins in same PDB: d3a74a2, d3a74b2, d3a74c2, d3a74d2
automated match to d1bbua1
protein/RNA complex; complexed with b4p, lyn, mg

Details for d3a74a1

PDB Entry: 3a74 (more details), 1.8 Å

PDB Description: Lysyl-tRNA synthetase from Bacillus stearothermophilus complexed with Diadenosine Tetraphosphate (AP4A)

PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3a74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a74a1 b.40.4.1 (A:4-145) Lysyl-tRNA synthetase (LysRS) {Geobacillus stearothermophilus [TaxId: 1422]}
elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
gelsikvssyefltkalrplpe

SCOPe Domain Coordinates for d3a74a1:

Click to download the PDB-style file with coordinates for d3a74a1.
(The format of our PDB-style files is described here.)

Timeline for d3a74a1: