Lineage for d3a74d2 (3a74 D:146-492)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532558Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2532666Protein Lysyl-tRNA synthetase (LysRS) [55685] (3 species)
    contains an insertion of LEM/SAP-like HeH motif, residues 337-379
  7. 2532678Species Geobacillus stearothermophilus [TaxId:1422] [225969] (1 PDB entry)
  8. 2532682Domain d3a74d2: 3a74 D:146-492 [208140]
    Other proteins in same PDB: d3a74a1, d3a74b1, d3a74c1, d3a74d1
    automated match to d1bbua2
    protein/RNA complex; complexed with b4p, lyn, mg

Details for d3a74d2

PDB Entry: 3a74 (more details), 1.8 Å

PDB Description: Lysyl-tRNA synthetase from Bacillus stearothermophilus complexed with Diadenosine Tetraphosphate (AP4A)
PDB Compounds: (D:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3a74d2:

Sequence, based on SEQRES records: (download)

>d3a74d2 d.104.1.1 (D:146-492) Lysyl-tRNA synthetase (LysRS) {Geobacillus stearothermophilus [TaxId: 1422]}
kyhglkdieqryrqryldlimnpeskktfitrsliiqsmrryldshgylevetpmmhava
ggaaarpfithhnaldmtlymriaielhlkrlivgglekvyeigrvfrnegistrhnpef
tmlelyeayadfrdimkltenliahiatevlgttkiqygehlvdltpewrrlhmvdaike
yvgvdfwrqmsdeearelakehgvevaphmtfghivneffeqkvedkliqptfiyghpve
isplakknpddprftdrfelfivgrehanaftelndpidqrqrfeeqlkereqgndeahe
mdedflealeygmpptgglgigvdrlvmlltnspsirdvllfpqmrh

Sequence, based on observed residues (ATOM records): (download)

>d3a74d2 d.104.1.1 (D:146-492) Lysyl-tRNA synthetase (LysRS) {Geobacillus stearothermophilus [TaxId: 1422]}
kdieqryrqryldlimnpeskktfitrsliiqsmrryldshgylevetpmmhavaggaaa
rpfithhnaldmtlymriaielhlkrlivgglekvyeigrvfrnegistrhnpeftmlel
yeayadfrdimkltenliahiatevlgttkiqygehlvdltpewrrlhmvdaikeyvgvd
fwrqmsdeearelakehgvevaphmtfghivneffeqkvedkliqptfiyghpveispla
kknpddprftdrfelfivgrehanaftelndpidqrqrfeeqlkereqgndeahemdedf
lealeygmpptgglgigvdrlvmlltnspsirdvllfpqmrh

SCOPe Domain Coordinates for d3a74d2:

Click to download the PDB-style file with coordinates for d3a74d2.
(The format of our PDB-style files is described here.)

Timeline for d3a74d2: