Lineage for d3a0hv_ (3a0h V:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980707Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1980762Protein Cytochrome c550 [100991] (3 species)
  7. 1980767Species Thermosynechococcus vulcanus [TaxId:32053] [259629] (5 PDB entries)
  8. 1980772Domain d3a0hv_: 3a0h V: [264656]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hv_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d3a0hv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hv_ a.3.1.1 (V:) Cytochrome c550 {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d3a0hv_:

Click to download the PDB-style file with coordinates for d3a0hv_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hv_: