SCOPe 2.06: Domain d3a0hj_: 3a0h J:

Lineage for d3a0hj_ (3a0h J:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family)
   automatically mapped to Pfam PF01788

5. Family f.23.32.1: PsbJ-like [161022] (2 proteins)
   Pfam PF01788

6. Protein Photosystem II reaction center protein J, PsbJ [161023] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [259622] (3 PDB entries)

8. Domain d3a0hj_: 3a0h J: [264648]
   Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hk_, d3a0hl_, d3a0hm_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
   complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hj_

PDB Entry: 3a0h, 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex

PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d3a0hj_:

Sequence; same for both SEQRES and ATOM records:

>d3a0hj_ f.23.32.1 (J:) Photosystem II reaction center protein J, PsbJ {Thermosynechococcus vulcanus [TaxId: 32053]}
riplwivatvagmgvivivglffygayaglgssl

Timeline for d3a0hj_:

• d3a0hj_ first appeared in SCOPe 2.05
  
• d3a0hj_ appears in SCOPe 2.07
  
• d3a0hj_ appears in the current release, SCOPe 2.08