Lineage for d3a0hm_ (3a0h M:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254869Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 2254870Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 2254888Protein automated matches [196649] (1 species)
    not a true protein
  7. 2254889Species Thermosynechococcus vulcanus [TaxId:32053] [196650] (2 PDB entries)
  8. 2254891Domain d3a0hm_: 3a0h M: [264651]
    Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_
    complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9

Details for d3a0hm_

PDB Entry: 3a0h (more details), 4 Å

PDB Description: Crystal structure of I-substituted Photosystem II complex
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d3a0hm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a0hm_ f.23.35.1 (M:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgfiatalfvlvpsvfliilyvqtesqqkss

SCOPe Domain Coordinates for d3a0hm_:

Click to download the PDB-style file with coordinates for d3a0hm_.
(The format of our PDB-style files is described here.)

Timeline for d3a0hm_: