Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) automatically mapped to Pfam PF05151 |
Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
Protein automated matches [196649] (1 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [196650] (2 PDB entries) |
Domain d3a0hm_: 3a0h M: [264651] Other proteins in same PDB: d3a0ha_, d3a0hb_, d3a0hc_, d3a0hd_, d3a0he_, d3a0hf_, d3a0hh_, d3a0hi_, d3a0hj_, d3a0hk_, d3a0hl_, d3a0hn_, d3a0ho_, d3a0ht_, d3a0hu_, d3a0hv_, d3a0hx_, d3a0hy_, d3a0hz_ complexed with bcr, cla, dgd, fe2, hem, iod, lhg, mge, oec, pho, pq9 |
PDB Entry: 3a0h (more details), 4 Å
SCOPe Domain Sequences for d3a0hm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a0hm_ f.23.35.1 (M:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mevnqlgfiatalfvlvpsvfliilyvqtesqqkss
Timeline for d3a0hm_: