Lineage for d2zcwa1 (2zcw A:117-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693005Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2693099Protein Transcriptional regulator TTHA1359, C-terminal domain [140233] (1 species)
  7. 2693100Species Thermus thermophilus [TaxId:274] [140234] (2 PDB entries)
    Uniprot Q5SIL0 118-199
  8. 2693101Domain d2zcwa1: 2zcw A:117-198 [171157]
    Other proteins in same PDB: d2zcwa2
    complexed with mpd

Details for d2zcwa1

PDB Entry: 2zcw (more details), 1.5 Å

PDB Description: Crystal Structure of TTHA1359, a Transcriptional Regulator, CRP/FNR family from Thermus thermophilus HB8
PDB Compounds: (A:) Transcriptional regulator, FNR/CRP family

SCOPe Domain Sequences for d2zcwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcwa1 a.4.5.4 (A:117-198) Transcriptional regulator TTHA1359, C-terminal domain {Thermus thermophilus [TaxId: 274]}
rlknrmaaallelsetplaheeegkvvlkathdelaaavgsvretvtkvigelaregyir
sgygkiqlldlkglkelaesrg

SCOPe Domain Coordinates for d2zcwa1:

Click to download the PDB-style file with coordinates for d2zcwa1.
(The format of our PDB-style files is described here.)

Timeline for d2zcwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zcwa2