SCOPe 2.08: Domain d2zcwa2: 2zcw A:5-116

Lineage for d2zcwa2 (2zcw A:5-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Transcriptional regulator TTHA1359, N-terminal domain [141641] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141642] (2 PDB entries)
   Uniprot Q5SIL0 6-117

8. Domain d2zcwa2: 2zcw A:5-116 [171158]
   Other proteins in same PDB: d2zcwa1
   complexed with mpd

Details for d2zcwa2

PDB Entry: 2zcw, 1.5 Å

PDB Description: Crystal Structure of TTHA1359, a Transcriptional Regulator, CRP/FNR family from Thermus thermophilus HB8

PDB Compounds: (A:) Transcriptional regulator, FNR/CRP family

SCOPe Domain Sequences for d2zcwa2:

Sequence; same for both SEQRES and ATOM records:

>d2zcwa2 b.82.3.2 (A:5-116) Transcriptional regulator TTHA1359, N-terminal domain {Thermus thermophilus [TaxId: 274]}
etvsfkagdvilypgvpgprdrayrvleglvrleavdeegnaltlrlvrpggffgeealf
gqeriyfaeaatdvrleplpenpdpellkdlaqhlsqglaeayrrierlatq

Timeline for d2zcwa2:

• d2zcwa2 first appeared in SCOPe 2.01
  
• d2zcwa2 appears in SCOPe 2.07