| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) ![]() duplication: consists of 2 subdomains of this fold |
| Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
| Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries) |
| Domain d2z2mf1: 2z2m F:626-692 [153947] Other proteins in same PDB: d2z2mb_, d2z2me_ automated match to d2z2mf1 complexed with cds, so4 |
PDB Entry: 2z2m (more details), 2.6 Å
SCOPe Domain Sequences for d2z2mf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z2mf1 d.11.1.1 (F:626-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aleqvsqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqq
vlilsdk
Timeline for d2z2mf1:
View in 3DDomains from other chains: (mouse over for more information) d2z2mb_, d2z2mc1, d2z2mc2, d2z2me_ |