Lineage for d2z2mb_ (2z2m B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619151Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 2619152Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)
  8. 2619162Domain d2z2mb_: 2z2m B: [153943]
    Other proteins in same PDB: d2z2mc1, d2z2mc2, d2z2mf1, d2z2mf2
    automated match to d2zc3b1
    complexed with cds, so4

Details for d2z2mb_

PDB Entry: 2z2m (more details), 2.6 Å

PDB Description: cefditoren-acylated penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
PDB Compounds: (B:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2z2mb_:

Sequence, based on SEQRES records: (download)

>d2z2mb_ e.3.1.1 (B:) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdad
tkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatird
wdvnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdey
agqlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtark
sqkeivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqi
adeknggylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasa
mkdslnl

Sequence, based on observed residues (ATOM records): (download)

>d2z2mb_ e.3.1.1 (B:) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdad
tkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatird
wdvnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdey
agqlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtark
sqkeivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqi
adgylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkds
lnl

SCOPe Domain Coordinates for d2z2mb_:

Click to download the PDB-style file with coordinates for d2z2mb_.
(The format of our PDB-style files is described here.)

Timeline for d2z2mb_: