Lineage for d2yoaa_ (2yoa A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1776026Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1776088Protein automated matches [190234] (2 species)
    not a true protein
  7. 1776095Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries)
  8. 1776099Domain d2yoaa_: 2yoa A: [197125]
    automated match to d1uova_
    complexed with ca, scn, sep

Details for d2yoaa_

PDB Entry: 2yoa (more details), 1.5 Å

PDB Description: synaptotagmin-1 c2b domain with phosphoserine
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2yoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yoaa_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
meklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktt
ikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrh
wsdmlanprrpiaqwhtlqveeevdamla

SCOPe Domain Coordinates for d2yoaa_:

Click to download the PDB-style file with coordinates for d2yoaa_.
(The format of our PDB-style files is described here.)

Timeline for d2yoaa_: