SCOPe 2.08: Domain d2yoaa1: 2yoa A:271-418

Lineage for d2yoaa1 (2yoa A:271-418)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein automated matches [190234] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries)

8. Domain d2yoaa1: 2yoa A:271-418 [197125]
   Other proteins in same PDB: d2yoaa2
   automated match to d1uova_
   complexed with ca, scn, sep

Details for d2yoaa1

PDB Entry: 2yoa, 1.5 Å

PDB Description: synaptotagmin-1 c2b domain with phosphoserine

PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2yoaa1:

Sequence; same for both SEQRES and ATOM records:

>d2yoaa1 b.7.1.2 (A:271-418) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamla

Timeline for d2yoaa1:

• d2yoaa1 first appeared in SCOPe 2.02, called d2yoaa_
  
• d2yoaa1 appears in SCOPe 2.07