SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2yoaa1 (2yoa A:271-418)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038183Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 2038246Protein automated matches [190234] (3 species)
    not a true protein
  7. 2038253Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (7 PDB entries)
  8. 2038257Domain d2yoaa1: 2yoa A:271-418 [197125]
    Other proteins in same PDB: d2yoaa2
    automated match to d1uova_
    complexed with ca, scn, sep

Details for d2yoaa1

PDB Entry: 2yoa (more details), 1.5 Å

PDB Description: Synaptotagmin-1 C2B domain with phosphoserine
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2yoaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yoaa1 b.7.1.2 (A:271-418) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamla

SCOPe Domain Coordinates for d2yoaa1:

Click to download the PDB-style file with coordinates for d2yoaa1.
(The format of our PDB-style files is described here.)

Timeline for d2yoaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yoaa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2yoab_