Lineage for d2wpis_ (2wpi S:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2064641Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 2064642Species Human (Homo sapiens) [TaxId:9606] [50585] (16 PDB entries)
  8. 2064655Domain d2wpis_: 2wpi S: [169544]
    Other proteins in same PDB: d2wpie_
    automated match to d1rfna_
    complexed with ca; mutant

Details for d2wpis_

PDB Entry: 2wpi (more details), 1.99 Å

PDB Description: factor ixa superactive double mutant
PDB Compounds: (S:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d2wpis_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpis_ b.47.1.2 (S:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d2wpis_:

Click to download the PDB-style file with coordinates for d2wpis_.
(The format of our PDB-style files is described here.)

Timeline for d2wpis_: