SCOPe 2.07: Domain d2wpis_: 2wpi S:

Lineage for d2wpis_ (2wpi S:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50585] (20 PDB entries)

8. Domain d2wpis_: 2wpi S: [169544]
   Other proteins in same PDB: d2wpie_
   automated match to d1rfna_
   complexed with ca; mutant

Details for d2wpis_

PDB Entry: 2wpi, 1.99 Å

PDB Description: factor ixa superactive double mutant

PDB Compounds: (S:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d2wpis_:

Sequence; same for both SEQRES and ATOM records:

>d2wpis_ b.47.1.2 (S:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

Timeline for d2wpis_:

• d2wpis_ first appeared in SCOPe 2.01
  
• d2wpis_ appears in SCOPe 2.06
  
• d2wpis_ appears in the current release, SCOPe 2.08